Skip to main content
Free UK Shipping on all £75+ orders|Next-Day Delivery, Order Before 2pm|Join AMP Rewards — Earn Points on Every Order|100 Bonus Points When You Sign Up|99%+ HPLC Verified — COA With Every Batch|Free UK Shipping on all £75+ orders|Next-Day Delivery, Order Before 2pm|Join AMP Rewards — Earn Points on Every Order|100 Bonus Points When You Sign Up|99%+ HPLC Verified — COA With Every Batch|Free UK Shipping on all £75+ orders|Next-Day Delivery, Order Before 2pm|Join AMP Rewards — Earn Points on Every Order|100 Bonus Points When You Sign Up|99%+ HPLC Verified — COA With Every Batch|Free UK Shipping on all £75+ orders|Next-Day Delivery, Order Before 2pm|Join AMP Rewards — Earn Points on Every Order|100 Bonus Points When You Sign Up|99%+ HPLC Verified — COA With Every Batch|
Home>Shop>IGF-1 LR3
99%+ Purity
HPLC Verified
UK Shipping
Secure Payment
Read our IGF-1 LR3 research guide

Product Highlights

  • Independently tested by third-party UK laboratories
  • Certificate of Analysis included with every order
  • Protective tracked packaging with tracked delivery
  • Next-day delivery on orders before 2pm

Earn 20% on First Order, 10% Lifetime

20% on their first order, then 10% on every purchase for life.

Join Now
99%+ Purity COA Included Secure Checkout Easy Returns
Growth Axis Peptide

IGF-1 LR3

4.9 · 7 reviews

Long-acting IGF-1 analogue

1
£42.49£66.3936% OFF

Limited time offer — 36% off original price

We acceptVisaMastercardApple PayGoogle Pay

Get notified when back in stock

For Research Use Only — Not for Human Consumption

UK Shipping
Express (Next Day)£4.99 (Free £75+)
Dispatch TimeBefore 2pm
CoverageUK Mainland Only
Research dataPubChem·PubMed
Full shipping details

Insulin-like Growth Factor-1 Long Arg3 (IGF-1 LR3) is a synthetic analogue of IGF-1 featuring an arginine substitution at position 3 and a 13-amino-acid N-terminal extension. These modifications significantly reduce IGF-1 LR3's binding to IGF binding proteins while maintaining high affinity for the IGF-1 receptor, making it a powerful research tool for studying cell proliferation, differentiation, and survival signalling pathways. Research applications span muscle cell biology, tissue regeneration models, and investigations into the IGF-1/PI3K/Akt/mTOR signalling cascade. The LR3 modification provides enhanced biological activity and extended half-life in research models compared to native IGF-1. AllMyPeptides supplies IGF-1 LR3 as a lyophilised research peptide with independent HPLC purity verification of 99%+ by independent third-party laboratories.

CAS Number

946870-92-4

Molecular Formula

C400H625N111O115S9

Molecular Weight

9117.5 g/mol

Appearance

White lyophilised powder

Sequence

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Need Help With Reconstitution?

Use our free Peptide Calculator and step-by-step Reconstitution Guide

Need Help?

Our UK-based support team is available Mon-Fri, 9am-5pm. Fast response within 24 hours.

Frequently Asked Questions

What is the purity of your IGF-1 LR3?+
Our IGF-1 LR3 is 99%+ pure, verified by independent third-party HPLC and mass spectrometry analysis. A Certificate of Analysis (COA) is included with every order.
How should I store IGF-1 LR3?+
IGF-1 LR3 should be stored in a cool, dry place away from direct light. For long-term storage, refrigeration at 2-8°C is recommended. Always reconstitute with bacteriostatic water and use proper aseptic technique.
How do I reconstitute IGF-1 LR3?+
Use our free Peptide Calculator to determine the correct amount of bacteriostatic water for your desired concentration. Slowly inject the water down the side of the vial — do not spray directly onto the peptide. Gently swirl until fully dissolved.
Is IGF-1 LR3 for human consumption?+
No. All products sold by AllMyPeptides are strictly for in vitro research and laboratory use only. They are not intended for human consumption, diagnostic, or therapeutic purposes. Purchasers must be qualified researchers aged 18 or over.
How quickly will my order arrive?+
Order before 2pm Monday to Friday and we dispatch the same day on Royal Mail Tracked Express — almost always with you the next working day. Free on orders over £75. We ship UK mainland only.