Product Highlights
- Independently tested by third-party UK laboratories
- Certificate of Analysis included with every order
- Protective tracked packaging with tracked delivery
- Next-day delivery on orders before 2pm
Earn 20% on First Order, 10% Lifetime
20% on their first order, then 10% on every purchase for life.
Need Help?
IGF-1 LR3
Long-acting IGF-1 analogue
Limited time offer — 36% off original price




Get notified when back in stock
For Research Use Only — Not for Human Consumption
Insulin-like Growth Factor-1 Long Arg3 (IGF-1 LR3) is a synthetic analogue of IGF-1 featuring an arginine substitution at position 3 and a 13-amino-acid N-terminal extension. These modifications significantly reduce IGF-1 LR3's binding to IGF binding proteins while maintaining high affinity for the IGF-1 receptor, making it a powerful research tool for studying cell proliferation, differentiation, and survival signalling pathways. Research applications span muscle cell biology, tissue regeneration models, and investigations into the IGF-1/PI3K/Akt/mTOR signalling cascade. The LR3 modification provides enhanced biological activity and extended half-life in research models compared to native IGF-1. AllMyPeptides supplies IGF-1 LR3 as a lyophilised research peptide with independent HPLC purity verification of 99%+ by independent third-party laboratories.
CAS Number
946870-92-4
Molecular Formula
C400H625N111O115S9
Molecular Weight
9117.5 g/mol
Appearance
White lyophilised powder
Sequence
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Need Help With Reconstitution?
Use our free Peptide Calculator and step-by-step Reconstitution Guide
Need Help?
Our UK-based support team is available Mon-Fri, 9am-5pm. Fast response within 24 hours.
Frequently Asked Questions
What is the purity of your IGF-1 LR3?+
How should I store IGF-1 LR3?+
How do I reconstitute IGF-1 LR3?+
Is IGF-1 LR3 for human consumption?+
How quickly will my order arrive?+
Related Products
Researchers commonly investigate these peptides alongside IGF-1 LR3



